Viral ODC1 protein

Artikelnummer: BYT-ORB10178
Artikelname: Viral ODC1 protein
Artikelnummer: BYT-ORB10178
Hersteller Artikelnummer: orb10178
Alternativnummer: BYT-ORB10178-20,BYT-ORB10178-100,BYT-ORB10178-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC
Recombinant of viral ODC1 protein
Molekulargewicht: 71.1 kDa
UniProt: P11926
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGV
Anwendungsbeschreibung: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-461aaSequence Info: Full LengthGlycerol content: 0.5