Viral ODC1 protein

Artikelnummer: BYT-ORB10178
Artikelname: Viral ODC1 protein
Artikelnummer: BYT-ORB10178
Hersteller Artikelnummer: orb10178
Alternativnummer: BYT-ORB10178-1,BYT-ORB10178-100,BYT-ORB10178-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC
This Viral ODC1 protein spans the amino acid sequence from region 1-461aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 71.1 kDa
UniProt: P11926
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-461aaSequence Info: Full LengthGlycerol content: 0.5
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) ODC1.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) ODC1.