Viral ODC1 protein

Product Overview

• Article Name: Viral ODC1 protein
• Biozol Catalog Number: BYT-ORB10178
• Supplier Catalog Number: orb10178
• Alternative Catalog Number: BYT-ORB10178-1,BYT-ORB10178-100,BYT-ORB10178-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC

Product Description

This Viral ODC1 protein spans the amino acid sequence from region 1-461aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 71.1 kDa
• UniProt: P11926
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVI

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-461aaSequence Info: Full LengthGlycerol content: 0.5

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) ODC1.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) ODC1.