Mouse Srpx2 protein
Artikelnummer:
BYT-ORB10299
- Bilder (3)
| Artikelname: | Mouse Srpx2 protein |
| Artikelnummer: | BYT-ORB10299 |
| Hersteller Artikelnummer: | orb10299 |
| Alternativnummer: | BYT-ORB10299-1,BYT-ORB10299-100,BYT-ORB10299-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Srpx2Sushi repeat-containing protein SRPX2 |
| This Mouse Srpx2 protein spans the amino acid sequence from region 26-468aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 70.5 kDa |
| UniProt: | Q8R054 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTC |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 26-468aaSequence Info: Full Length of Mature Protein |



