Mouse Srpx2 protein

Catalog Number: BYT-ORB10299
Article Name: Mouse Srpx2 protein
Biozol Catalog Number: BYT-ORB10299
Supplier Catalog Number: orb10299
Alternative Catalog Number: BYT-ORB10299-1,BYT-ORB10299-100,BYT-ORB10299-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: Srpx2Sushi repeat-containing protein SRPX2
Recombinant of mouse Srpx2 protein
Molecular Weight: 70.5 kDa
UniProt: Q8R054
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLT
Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 26-468aaSequence Info: Full Length of Mature Protein