Bacterial chp protein

Produktübersicht

• Artikelname: Bacterial chp protein
• Artikelnummer: BYT-ORB10427
• Hersteller Artikelnummer: orb10427
• Alternativnummer: BYT-ORB10427-1,BYT-ORB10427-100,BYT-ORB10427-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: CHIPS

Produktbeschreibung

This Bacterial chp protein spans the amino acid sequence from region 29-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 16.1 kDa
• UniProt: Q6GFB3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Staphylococcus aureus (strain MRSA252)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain MRSA252). Application Notes: Tag info: N-terminal 6xHis-taggedExpression Region: 29-149aaSequence Info: Fulllengthofmatureprotein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp.