Bacterial chp protein
Catalog Number:
BYT-ORB10427
- Images (3)
| Article Name: | Bacterial chp protein |
| Biozol Catalog Number: | BYT-ORB10427 |
| Supplier Catalog Number: | orb10427 |
| Alternative Catalog Number: | BYT-ORB10427-1,BYT-ORB10427-100,BYT-ORB10427-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | CHIPS |
| This Bacterial chp protein spans the amino acid sequence from region 29-149aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 16.1 kDa |
| UniProt: | Q6GFB3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Staphylococcus aureus (strain MRSA252) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY |
| Application Notes: | Biological Origin: Staphylococcus aureus (strain MRSA252). Application Notes: Tag info: N-terminal 6xHis-taggedExpression Region: 29-149aaSequence Info: Fulllengthofmatureprotein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain MRSA252) chp. |
Product Guarantee and Expert Support
