Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active)

Produktübersicht

• Artikelname: Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active)
• Artikelnummer: BYT-ORB1095866
• Hersteller Artikelnummer: orb1095866
• Alternativnummer: BYT-ORB1095866-1,BYT-ORB1095866-100,BYT-ORB1095866-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Nectin-like protein 5)(NECL-5)(CD antigen CD155)

Produktbeschreibung

This Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active) spans the amino acid sequence from region 21-343aa(I340M). Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 64.0 kDa
• UniProt: P15151
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT.