Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active)

Product Overview

• Article Name: Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active)
• Biozol Catalog Number: BYT-ORB1095866
• Supplier Catalog Number: orb1095866
• Alternative Catalog Number: BYT-ORB1095866-1,BYT-ORB1095866-100,BYT-ORB1095866-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (Nectin-like protein 5)(NECL-5)(CD antigen CD155)

Product Description

This Recombinant Human Poliovirus receptor (PVR) (I340M), partial (Active) spans the amino acid sequence from region 21-343aa(I340M). Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 64.0 kDa
• UniProt: P15151
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPT

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

FACS assay shows that Human PVR can bind to HEK293F cell overexpressing human TIGIT.