Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

Produktübersicht

• Artikelname: Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)
• Artikelnummer: BYT-ORB1095887
• Hersteller Artikelnummer: orb1095887
• Alternativnummer: BYT-ORB1095887-1,BYT-ORB1095887-100,BYT-ORB1095887-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

This Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) spans the amino acid sequence from region 63-234aa. Purity: Greater than 94% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 45.8 kDa
• UniProt: P32971
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 94% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 µg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

orb1095887

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 µg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.