Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)
Catalog Number:
BYT-ORB1095887
- Images (4)
| Article Name: | Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) |
| Biozol Catalog Number: | BYT-ORB1095887 |
| Supplier Catalog Number: | orb1095887 |
| Alternative Catalog Number: | BYT-ORB1095887-1,BYT-ORB1095887-100,BYT-ORB1095887-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| This Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) spans the amino acid sequence from region 63-234aa. Purity: Greater than 94% as determined by SDS-PAGE. |
| Molecular Weight: | 45.8 kDa |
| UniProt: | P32971 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 94% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 µg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |




