Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

Catalog Number: BYT-ORB1095887
Article Name: Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)
Biozol Catalog Number: BYT-ORB1095887
Supplier Catalog Number: orb1095887
Alternative Catalog Number: BYT-ORB1095887-1,BYT-ORB1095887-100,BYT-ORB1095887-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) spans the amino acid sequence from region 63-234aa. Purity: Greater than 94% as determined by SDS-PAGE.
Molecular Weight: 45.8 kDa
UniProt: P32971
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 94% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 µg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb1095887
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 µg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.