SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein Preis auf Anfrage

Artikelnummer: BYT-ORB1231618
Artikelname: SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein Preis auf Anfrage
Artikelnummer: BYT-ORB1231618
Hersteller Artikelnummer: orb1231618
Alternativnummer: BYT-ORB1231618-0.1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: ELISA, WB
Alternative Synonym: covid-19, sars-cov-2
SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein
Konzentration: 0.5 mg/ml
Molekulargewicht: The predicted molecular weight of Recombinant SARS-CoV-2, Nucleocapsid (N) Protein is Mr 47 kDa.
NCBI: 62115
Puffer: This recombinant protein was 0.2 µm filtered and lyophilized from modified Dulbeccos phosphate buffered saline (1X PBS) pH 7.2 - 7.3 with no calcium, magnesium, or preservatives.
Reinheit: >95% by SDS Page
Formulierung: Liquid
Sequenz: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALT QHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTG PEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGS RGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMS GKGQQQQGQTVTKKSA
Anwendungsbeschreibung: Application Notes: ELISA, WB
Purified SARS-CoV-2 Nucleocapsid (N) Protein. Lane 1-Nucleocaspid protein under reducing conditions loaded at 10 µg. Lane 2-Nucleocaspid protein under non-reducing conditions loaded at 10 µg