SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein Preis auf Anfrage

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein Preis auf Anfrage
• Biozol Catalog Number: BYT-ORB1231618
• Supplier Catalog Number: orb1231618
• Alternative Catalog Number: BYT-ORB1231618-0.1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: ELISA, WB
• Alternative Names: covid-19, sars-cov-2

Product Description

SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein

Product Properties

• Concentration: 0.5 mg/ml
• Molecular Weight: The predicted molecular weight of Recombinant SARS-CoV-2, Nucleocapsid (N) Protein is Mr 47 kDa.
• NCBI: 62115
• Buffer: This recombinant protein was 0.2 µm filtered and lyophilized from modified Dulbeccos phosphate buffered saline (1X PBS) pH 7.2 - 7.3 with no calcium, magnesium, or preservatives.
• Purity: >95% by SDS Page
• Form: Liquid
• Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALT QHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTG PEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGS RGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMS GKGQQQQGQTVTKKSA

Application Notes

• Application Notes: Application Notes: ELISA, WB

Images

Purified SARS-CoV-2 Nucleocapsid (N) Protein. Lane 1-Nucleocaspid protein under reducing conditions loaded at 10 µg. Lane 2-Nucleocaspid protein under non-reducing conditions loaded at 10 µg