Membrane Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463305
Artikelname: Membrane Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463305
Hersteller Artikelnummer: orb1463305
Alternativnummer: BYT-ORB1463305-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli. Antigen Sequence: LRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD
Konjugation: Unconjugated
Alternative Synonym: M SARS Coronavirus-2 antibody., ORF5, sars-cov-2
Membrane protein (E) is one of the structural proteins of the virus. This glycoprotein that is the most abundant protein in the coronavirus envelope might act as a scaffold for the co-assembly of the complex of structural and accessory proteins that form the viral envelope.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: Membrane Protein (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use