Membrane Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463305
Article Name: Membrane Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463305
Supplier Catalog Number: orb1463305
Alternative Catalog Number: BYT-ORB1463305-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli. Antigen Sequence: LRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD
Conjugation: Unconjugated
Alternative Names: M SARS Coronavirus-2 antibody., ORF5, sars-cov-2
Membrane protein (E) is one of the structural proteins of the virus. This glycoprotein that is the most abundant protein in the coronavirus envelope might act as a scaffold for the co-assembly of the complex of structural and accessory proteins that form the viral envelope.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: Membrane Protein (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: Application Notes: The antibody solution should be gently mixed before use