Envelope Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463314
Artikelname: Envelope Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463314
Hersteller Artikelnummer: orb1463314
Alternativnummer: BYT-ORB1463314-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Envelope protein (residues 45 to stop) and produced in E. coli. Antigen Sequence: MNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Konjugation: Unconjugated
Alternative Synonym: E SARS Coronavirus-2 antibody., ORF4, sars-cov-2
Envelope (E) is one of the structural proteins of the virus. This protein is a small polypeptide that contains at least one alpha-helical transmembrane domain and it involved in life cycle of SARS-CoV-2, such as assembly, budding, envelope formation.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: Envelope Protein (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use