Envelope Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463314
Article Name: Envelope Protein (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463314
Supplier Catalog Number: orb1463314
Alternative Catalog Number: BYT-ORB1463314-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Envelope protein (residues 45 to stop) and produced in E. coli. Antigen Sequence: MNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Conjugation: Unconjugated
Alternative Names: E SARS Coronavirus-2 antibody., ORF4, sars-cov-2
Envelope (E) is one of the structural proteins of the virus. This protein is a small polypeptide that contains at least one alpha-helical transmembrane domain and it involved in life cycle of SARS-CoV-2, such as assembly, budding, envelope formation.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: Envelope Protein (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: Application Notes: The antibody solution should be gently mixed before use