ORF3a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463331
Artikelname: ORF3a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463331
Hersteller Artikelnummer: orb1463331
Alternativnummer: BYT-ORB1463331-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli.. Antigen Sequence: MNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
Konjugation: Unconjugated
Alternative Synonym: ORF3a SARS Coronavirus-2 antibody., sars-cov-2
ORF3a encodes a viral accessory and uncharacterised protein with possible role in the viral life cycle. Six functional domains have been identified and have linked to infectivity, virulence, ion channel formation and virus release.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: ORF3a (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use