ORF3a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463331
Article Name: ORF3a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463331
Supplier Catalog Number: orb1463331
Alternative Catalog Number: BYT-ORB1463331-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli. Antigen Sequence: MNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
Conjugation: Unconjugated
Alternative Names: ORF3a SARS Coronavirus-2 antibody., sars-cov-2
ORF3a encodes a viral accessory and uncharacterised protein with possible role in the viral life cycle. Six functional domains have been identified and have linked to infectivity, virulence, ion channel formation and virus release.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: ORF3a (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: Application Notes: The antibody solution should be gently mixed before use