Antigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 320 to 420) and produced in E. coli. Antigen Sequence: NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion.
Klonalität:
Polyclonal
Konzentration:
1 mg/ml
Puffer:
PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie:
Spike RBD Domain (SARS-CoV-2)
Application Verdünnung:
WB:1:500-1:2,000
Anwendungsbeschreibung:
Application Notes: The antibody solution should be gently mixed before use
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten