Spike RBD Domain (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463332
Article Name: Spike RBD Domain (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463332
Supplier Catalog Number: orb1463332
Alternative Catalog Number: BYT-ORB1463332-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 320 to 420) and produced in E. coli. Antigen Sequence: NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
Conjugation: Unconjugated
Alternative Names: S glycoprotein SARS Coronavirus-2, Spike RBD Domain SARS Coronavirus-2 antibody., sars-cov-2
The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: Spike RBD Domain (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: Application Notes: The antibody solution should be gently mixed before use