Nucleocapsid (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463333
Artikelname: Nucleocapsid (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463333
Hersteller Artikelnummer: orb1463333
Alternativnummer: BYT-ORB1463333-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nucleocapsid (residues 280 to stop) and produced in E. coli. Antigen Sequence: MQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Konjugation: Unconjugated
Alternative Synonym: SARS Coronavirus-2, SARS-CoV-2 N protein antibody., SARS-CoV-2 NP, sars-cov-2
The nucleocapsid protein is one of the core components of the SARS coronavirus (CoV). This protein forms a closed capsule, inside which the genomic RNA is securely stored, and it is also involved in packaging the RNA into virus particles.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: Nucleocapsid (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use