Nucleocapsid (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Catalog Number: BYT-ORB1463333
Article Name: Nucleocapsid (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Biozol Catalog Number: BYT-ORB1463333
Supplier Catalog Number: orb1463333
Alternative Catalog Number: BYT-ORB1463333-100
Manufacturer: Biorbyt
Host: Goat
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nucleocapsid (residues 280 to stop) and produced in E. coli. Antigen Sequence: MQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Conjugation: Unconjugated
Alternative Names: SARS Coronavirus-2, SARS-CoV-2 N protein antibody., SARS-CoV-2 NP, sars-cov-2
The nucleocapsid protein is one of the core components of the SARS coronavirus (CoV). This protein forms a closed capsule, inside which the genomic RNA is securely stored, and it is also involved in packaging the RNA into virus particles.
Clonality: Polyclonal
Concentration: 1 mg/ml
Buffer: PBS, 20% glycerol and 0.05% sodium azide
Target: Nucleocapsid (SARS-CoV-2)
Application Dilute: WB:1:500-1:2,000
Application Notes: The antibody solution should be gently mixed before use.