Human IL17A Protein
Artikelnummer:
BYT-ORB1476713
- Bilder (4)
| Artikelname: | Human IL17A Protein |
| Artikelnummer: | BYT-ORB1476713 |
| Hersteller Artikelnummer: | orb1476713 |
| Alternativnummer: | BYT-ORB1476713-1,BYT-ORB1476713-100,BYT-ORB1476713-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated antigen 8)(CTLA-8) |
| This Human IL17A Protein spans the amino acid sequence from region 24-155aa(T26A). Purity: Greater than 95% as determined by SDS-PAGE. |
| Molekulargewicht: | 15.9 kDa |
| UniProt: | Q16552 |
| Puffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 µg/ml can bind Anti-IL17A recombinant antibody, the EC50 is 1.818-2.170 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |




