Human IL17A Protein

Product Overview

• Article Name: Human IL17A Protein
• Biozol Catalog Number: BYT-ORB1476713
• Supplier Catalog Number: orb1476713
• Alternative Catalog Number: BYT-ORB1476713-1,BYT-ORB1476713-100,BYT-ORB1476713-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated antigen 8)(CTLA-8)

Product Description

This Human IL17A Protein spans the amino acid sequence from region 24-155aa(T26A). Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 15.9 kDa
• UniProt: Q16552
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 µg/ml can bind Anti-IL17A recombinant antibody, the EC50 is 1.818-2.170 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

orb1476713

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 µg/ml can bind Anti-IL17A recombinant antibody, the EC50 is 1.818-2.170 ng/mL.