Recombinant Human metapneumovirus Fusion glycoprotein F0 (F), partial

Produktübersicht

• Artikelname: Recombinant Human metapneumovirus Fusion glycoprotein F0 (F), partial
• Artikelnummer: BYT-ORB1674325
• Hersteller Artikelnummer: orb1674325
• Alternativnummer: BYT-ORB1674325-20,BYT-ORB1674325-100,BYT-ORB1674325-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Alternative Synonym: (Protein F)

Produktbeschreibung

Recombinant Human metapneumovirus Fusion glycoprotein F0(F),partial

Produkteigenschaften

• Molekulargewicht: 12.2 kDa
• UniProt: Q6WB98
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human metapneumovirus (strain CAN97-83) (HMPV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCSDGPSLIKTELDLTKSALRELKTVSADQLAREEQIENPRQSR

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration