Recombinant Human metapneumovirus Fusion glycoprotein F0 (F), partial

Catalog Number: BYT-ORB1674325
Article Name: Recombinant Human metapneumovirus Fusion glycoprotein F0 (F), partial
Biozol Catalog Number: BYT-ORB1674325
Supplier Catalog Number: orb1674325
Alternative Catalog Number: BYT-ORB1674325-20,BYT-ORB1674325-100,BYT-ORB1674325-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Virus
Alternative Names: (Protein F)
Recombinant Human metapneumovirus Fusion glycoprotein F0(F),partial
Molecular Weight: 12.2 kDa
UniProt: Q6WB98
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human metapneumovirus (strain CAN97-83) (HMPV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCSDGPSLIKTELDLTKSALRELKTVSADQLAREEQIENPRQSR
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration