Recombinant Human Meiotic recombination protein SPO11 (SPO11)

Produktübersicht

• Artikelname: Recombinant Human Meiotic recombination protein SPO11 (SPO11)
• Artikelnummer: BYT-ORB1674327
• Hersteller Artikelnummer: orb1674327
• Alternativnummer: BYT-ORB1674327-20,BYT-ORB1674327-100,BYT-ORB1674327-500,BYT-ORB1674327-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: (Cancer/testis antigen 35)(CT35)

Produktbeschreibung

Recombinant Human Meiotic recombination protein SPO11(SPO11)

Produkteigenschaften

• Molekulargewicht: 47.3 kDa
• UniProt: Q9Y5K1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPD

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration