Recombinant Human Meiotic recombination protein SPO11 (SPO11)

Catalog Number: BYT-ORB1674327
Article Name: Recombinant Human Meiotic recombination protein SPO11 (SPO11)
Biozol Catalog Number: BYT-ORB1674327
Supplier Catalog Number: orb1674327
Alternative Catalog Number: BYT-ORB1674327-20,BYT-ORB1674327-100,BYT-ORB1674327-500,BYT-ORB1674327-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: (Cancer/testis antigen 35)(CT35)
Recombinant Human Meiotic recombination protein SPO11(SPO11)
Molecular Weight: 47.3 kDa
UniProt: Q9Y5K1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPD
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration