Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1)

Artikelnummer: BYT-ORB1674328
Artikelname: Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1)
Artikelnummer: BYT-ORB1674328
Hersteller Artikelnummer: orb1674328
Alternativnummer: BYT-ORB1674328-20,BYT-ORB1674328-100,BYT-ORB1674328-500,BYT-ORB1674328-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Recombinant Mouse Dexamethasone-induced Ras-related protein 1(Rasd1)
Molekulargewicht: 34.2 kDa
UniProt: O35626
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSV
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration