Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1)

Catalog Number: BYT-ORB1674328
Article Name: Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1)
Biozol Catalog Number: BYT-ORB1674328
Supplier Catalog Number: orb1674328
Alternative Catalog Number: BYT-ORB1674328-20,BYT-ORB1674328-100,BYT-ORB1674328-500,BYT-ORB1674328-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Mouse
Recombinant Mouse Dexamethasone-induced Ras-related protein 1(Rasd1)
Molecular Weight: 34.2 kDa
UniProt: O35626
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSV
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration