Human LR3 IGF1 Protein

Produktübersicht

• Artikelname: Human LR3 IGF1 Protein
• Artikelnummer: BYT-ORB168743
• Hersteller Artikelnummer: orb168743
• Alternativnummer: BYT-ORB168743-0.5,BYT-ORB168743-1,BYT-ORB168743-200
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.

Produktbeschreibung

Recombinant of Human LR3 IGF1 protein

Produkteigenschaften

• Puffer: Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.2.
• Reinheit: Greater than 97.0% as determined by SDS-PAGE and HPLC.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. Application Notes: Cytokines And Growth Factors