Human LR3 IGF1 Protein

Product Overview

• Article Name: Human LR3 IGF1 Protein
• Biozol Catalog Number: BYT-ORB168743
• Supplier Catalog Number: orb168743
• Alternative Catalog Number: BYT-ORB168743-0.5,BYT-ORB168743-1,BYT-ORB168743-200
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.

Product Description

Recombinant of Human LR3 IGF1 protein

Product Properties

• Buffer: Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.2.
• Purity: Greater than 97.0% as determined by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Application Notes

• Application Notes: Solubility: It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. Application Notes: Cytokines And Growth Factors