Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)
• Artikelnummer: BYT-ORB1785015
• Hersteller Artikelnummer: orb1785015
• Alternativnummer: BYT-ORB1785015-1,BYT-ORB1785015-100,BYT-ORB1785015-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: C-C CKR-9, CC-CKR-9, CCR-9,G-protein coupled receptor 28,GPR-9-6

Produktbeschreibung

This Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active) spans the sequence from region 1-369aa.

Produkteigenschaften

• Molekulargewicht: 43.4 kDa
• UniProt: P51686
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Homo sapiens (Human)
• Formulierung: Lyophilized powder
• Sequenz: MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 µg/mL can bind Anti-CCR9 recombinant antibody. The EC50 is 31.67-36.83 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Bilder

Detected by Mouse anti-6*His monoclonal antibody.

The purity of VLPs was greater than 95% as determined by HPLC-SEC.

Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10µg/mL can bind Anti-CCR9 recombinant antibody, the EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.