Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)
Catalog Number:
BYT-ORB1785015
- Images (3)
| Article Name: | Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active) |
| Biozol Catalog Number: | BYT-ORB1785015 |
| Supplier Catalog Number: | orb1785015 |
| Alternative Catalog Number: | BYT-ORB1785015-1,BYT-ORB1785015-100,BYT-ORB1785015-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | C-C CKR-9, CC-CKR-9, CCR-9,G-protein coupled receptor 28,GPR-9-6 |
| This Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active) spans the sequence from region 1-369aa. |
| Molecular Weight: | 43.4 kDa |
| UniProt: | P51686 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Source: | Homo sapiens (Human) |
| Form: | Lyophilized powder |
| Sequence: | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKV |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 µg/mL can bind Anti-CCR9 recombinant antibody. The EC50 is 31.67-36.83 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing |



