Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active)
Artikelnummer:
BYT-ORB1881863
- Bilder (3)
| Artikelname: | Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active) |
| Artikelnummer: | BYT-ORB1881863 |
| Hersteller Artikelnummer: | orb1881863 |
| Alternativnummer: | BYT-ORB1881863-20,BYT-ORB1881863-100,BYT-ORB1881863-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | CKRL3,CMKBR6,GPR29,STRL22 |
| This Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active) spans the sequence from region 1-374aa. |
| Molekulargewicht: | 42.5 kDa |
| UniProt: | P51684 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Quelle: | Homo sapiens (Human) |
| Formulierung: | Lyophilized powder |
| Sequenz: | MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRV |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR6 at 10 µg/mL can bind Anti-CCR6 recombinant antibody. The EC50 is 44.79-56.10 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing |



