Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active)

Product Overview

• Article Name: Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active)
• Biozol Catalog Number: BYT-ORB1881863
• Supplier Catalog Number: orb1881863
• Alternative Catalog Number: BYT-ORB1881863-20,BYT-ORB1881863-100,BYT-ORB1881863-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CKRL3,CMKBR6,GPR29,STRL22

Product Description

This Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active) spans the sequence from region 1-374aa.

Product Properties

• Molecular Weight: 42.5 kDa
• UniProt: P51684
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Source: Homo sapiens (Human)
• Form: Lyophilized powder
• Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR6 at 10 µg/mL can bind Anti-CCR6 recombinant antibody. The EC50 is 44.79-56.10 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Images

Detected by Mouse anti-6*His monoclonal antibody. The two bands respectively correspond to monomer, Homodimer.

Measured by its binding ability in a functional ELISA. Immobilized Human CCR6 at 10µg/mL can bind Anti-CCR6 recombinant antibody, the EC50 is 44.79-56.10 ng/mL.VLPs is negative control.

The purity of VLPs was greater than 90% as determined by SEC-HPLC