COX2/Cyclooxygenase 2/PTGS2 Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: COX2/Cyclooxygenase 2/PTGS2 Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB19202
• Hersteller Artikelnummer: orb19202
• Alternativnummer: BYT-ORB19202-10,BYT-ORB19202-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: Prostaglandin G/H synthase 2,1.14.99.1,Cyclooxygenase-2,COX-2,PHS II,Prostaglandin H2 synthase 2,PGH synthase 2,PGHS-2,Prostaglandin-endoperoxide synthase 2,PTGS2,COX2,

Produktbeschreibung

COX2/Cyclooxygenase 2/PTGS2 Antibody

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molekulargewicht: 68996 MW
• UniProt: P35354
• Formulierung: Lyophilized

Anwendungsbeschreibung

• Application Verdünnung: Western blot, 0.1-0.5µg/ml, Human
• Anwendungsbeschreibung: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.