A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
* VAT and and shipping costs not included. Errors and price changes excepted