COX2/Cyclooxygenase 2/PTGS2 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: COX2/Cyclooxygenase 2/PTGS2 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB19202
• Supplier Catalog Number: orb19202
• Alternative Catalog Number: BYT-ORB19202-10,BYT-ORB19202-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
• Conjugation: Unconjugated
• Alternative Names: Prostaglandin G/H synthase 2,1.14.99.1,Cyclooxygenase-2,COX-2,PHS II,Prostaglandin H2 synthase 2,PGH synthase 2,PGHS-2,Prostaglandin-endoperoxide synthase 2,PTGS2,COX2,

Product Description

COX2/Cyclooxygenase 2/PTGS2 Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molecular Weight: 68996 MW
• UniProt: P35354
• Form: Lyophilized

Application Notes

• Application Dilute: Western blot, 0.1-0.5µg/ml, Human
• Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.