INADL Peptide - N-terminal region

Produktübersicht

• Artikelname: INADL Peptide - N-terminal region
• Artikelnummer: BYT-ORB1997471
• Hersteller Artikelnummer: orb1997471
• Alternativnummer: BYT-ORB1997471-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cipp, INADL, hINADL, InaD-like

Produktbeschreibung

INADL Peptide - N-terminal region

Produkteigenschaften

• NCBI: 795352
• UniProt: Q8NI35
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: EIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with INADL Rabbit Polyclonal Antibody (orb635619). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings