INADL Peptide - N-terminal region

Product Overview

• Article Name: INADL Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997471
• Supplier Catalog Number: orb1997471
• Alternative Catalog Number: BYT-ORB1997471-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cipp, INADL, hINADL, InaD-like

Product Description

INADL Peptide - N-terminal region

Product Properties

• NCBI: 795352
• UniProt: Q8NI35
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with INADL Rabbit Polyclonal Antibody (orb635619). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings