INVS Peptide - C-terminal region

Produktübersicht

• Artikelname: INVS Peptide - C-terminal region
• Artikelnummer: BYT-ORB1997476
• Hersteller Artikelnummer: orb1997476
• Alternativnummer: BYT-ORB1997476-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: INV, NPH2, NPHP2

Produktbeschreibung

INVS Peptide - C-terminal region

Produkteigenschaften

• NCBI: 055240
• UniProt: Q9Y283
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: ALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEM

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with INVS Rabbit Polyclonal Antibody (orb635623). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings