INVS Peptide - C-terminal region

Product Overview

• Article Name: INVS Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997476
• Supplier Catalog Number: orb1997476
• Alternative Catalog Number: BYT-ORB1997476-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: INV, NPH2, NPHP2

Product Description

INVS Peptide - C-terminal region

Product Properties

• NCBI: 055240
• UniProt: Q9Y283
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEM

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with INVS Rabbit Polyclonal Antibody (orb635623). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings