EPHA10 Peptide - C-terminal region

Produktübersicht

• Artikelname: EPHA10 Peptide - C-terminal region
• Artikelnummer: BYT-ORB1997479
• Hersteller Artikelnummer: orb1997479
• Alternativnummer: BYT-ORB1997479-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

EPHA10 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001092909
• UniProt: Q5JZY3
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIHSIL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with EPHA10 Rabbit Polyclonal Antibody (orb586543). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings