EPHA10 Peptide - C-terminal region

Product Overview

• Article Name: EPHA10 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997479
• Supplier Catalog Number: orb1997479
• Alternative Catalog Number: BYT-ORB1997479-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

EPHA10 Peptide - C-terminal region

Product Properties

• NCBI: 001092909
• UniProt: Q5JZY3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIHSIL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with EPHA10 Rabbit Polyclonal Antibody (orb586543). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings