HERC3 Peptide - N-terminal region

Produktübersicht

• Artikelname: HERC3 Peptide - N-terminal region
• Artikelnummer: BYT-ORB1997484
• Hersteller Artikelnummer: orb1997484
• Alternativnummer: BYT-ORB1997484-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

HERC3 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 055421
• UniProt: Q15034
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: PLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with HERC3 Rabbit Polyclonal Antibody (orb578743). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings