HERC3 Peptide - N-terminal region

Product Overview

• Article Name: HERC3 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997484
• Supplier Catalog Number: orb1997484
• Alternative Catalog Number: BYT-ORB1997484-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

HERC3 Peptide - N-terminal region

Product Properties

• NCBI: 055421
• UniProt: Q15034
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with HERC3 Rabbit Polyclonal Antibody (orb578743). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings