BCL11B Peptide - N-terminal region

Produktübersicht

• Artikelname: BCL11B Peptide - N-terminal region
• Artikelnummer: BYT-ORB1997487
• Hersteller Artikelnummer: orb1997487
• Alternativnummer: BYT-ORB1997487-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha

Produktbeschreibung

BCL11B Peptide - N-terminal region

Produkteigenschaften

• NCBI: 612808
• UniProt: Q9C0K0
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with BCL11B Rabbit Polyclonal Antibody (orb577302). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings