BCL11B Peptide - N-terminal region

Product Overview

• Article Name: BCL11B Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB1997487
• Supplier Catalog Number: orb1997487
• Alternative Catalog Number: BYT-ORB1997487-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha

Product Description

BCL11B Peptide - N-terminal region

Product Properties

• NCBI: 612808
• UniProt: Q9C0K0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with BCL11B Rabbit Polyclonal Antibody (orb577302). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings