DDX10 Peptide - C-terminal region

Artikelnummer: BYT-ORB1997490
Artikelname: DDX10 Peptide - C-terminal region
Artikelnummer: BYT-ORB1997490
Hersteller Artikelnummer: orb1997490
Alternativnummer: BYT-ORB1997490-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HRH-J8
DDX10 Peptide - C-terminal region
NCBI: 004389
UniProt: Q13206
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with DDX10 Rabbit Polyclonal Antibody (orb575931). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings