DDX10 Peptide - C-terminal region

Product Overview

• Article Name: DDX10 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB1997490
• Supplier Catalog Number: orb1997490
• Alternative Catalog Number: BYT-ORB1997490-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HRH-J8

Product Description

DDX10 Peptide - C-terminal region

Product Properties

• NCBI: 004389
• UniProt: Q13206
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DDX10 Rabbit Polyclonal Antibody (orb575931). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings